PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID kfl00150_0040
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Klebsormidiophyceae; Klebsormidiales; Klebsormidiaceae; Klebsormidium
Family MYB
Protein Properties Length: 1158aa    MW: 122461 Da    PI: 5.938
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
kfl00150_0040genomeKFGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding35.91.8e-1188129346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +W++ Ed  l++ vk+ G+  W+++ r++g  Rt+kqc++r+++
    kfl00150_0040  88 KWSKKEDVVLLNFVKENGKAGWARVGRMLG--RTGKQCRNRFYN 129
                      8****************************8..***********9 PP

2Myb_DNA-binding249.1e-08139250345
                      SS-HHHHHHHHHHHHHTTTT......................................................................-HHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGgg......................................................................tWkt 26 
                       WT+eEd   v+++k++G +                                                                      +W+ 
    kfl00150_0040 139 EWTAEEDRCMVELHKRFGCRlvfsqrnpeglqlhdlrlqkdvtglfftlpssfsfvsprrpgpqecckvilvlifqmssykvlsnssffsRWAI 232
                      7********************************************************************************************* PP

                      HHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding  27 IartmgkgRtlkqcksrwq 45 
                       ar+++ gR  + +k++w+
    kfl00150_0040 233 LARHLP-GRGQNTIKNHWN 250
                      ******.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.81981135IPR017930Myb domain
SMARTSM007174.3E-985133IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.2E-1688148IPR009057Homeodomain-like
CDDcd001673.18E-888129No hitNo description
SuperFamilySSF466893.74E-1688135IPR009057Homeodomain-like
PfamPF139212.1E-1189146No hitNo description
PROSITE profilePS500906.295132253IPR017877Myb-like domain
SMARTSM007170.16136255IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.0E-10149158IPR009057Homeodomain-like
SuperFamilySSF466893.74E-16225253IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.0E-10229251IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1158 aa     Download sequence    Send to blast
MESSVPIVES APEDAIENPI CIIGFEEPSP ELAGGKGFTA PGNQGEGWKQ KPHNGHKFRD  60
KAARESGTLD PGSGSDGGKA GEMRPLPKWS KKEDVVLLNF VKENGKAGWA RVGRMLGRTG  120
KQCRNRFYNA LDPELSAKEW TAEEDRCMVE LHKRFGCRLV FSQRNPEGLQ LHDLRLQKDV  180
TGLFFTLPSS FSFVSPRRPG PQECCKVILV LIFQMSSYKV LSNSSFFSRW AILARHLPGR  240
GQNTIKNHWN CVARTCKDTS TSAKKFAPSP LRAYIASLKP SLENRGESDK GVISSQPGAP  300
SDMEESDKPL PLTALPGGPE IAIAQAGEDP GETGDPPRLR MPIVSDGKPP VALTLDNVIE  360
EGPTAKLARK LGAENDGPVI PLKKQRSESP ERGRGETPLG GASKRSHSAG TVWRLDQISQ  420
WITEWAKPGD VPRGGSPVPV QERGGFQDPQ VGTPRMRATS SGSPQAGSLD STRKRDRGVI  480
DFGENESGER PAESGGHFDW KAQLLAQWTS SRSGGSPEQT AFHLTETGGS TPVTIPLQKQ  540
GRGSAFVATG GAAKRKTRQG GEGHSPRAGG LVVSDLPLDE IDASGGSSGS GNSAEENFDW  600
KAQWAILNAR HPGPGGGAEQ QLPRGGVRWE DMVSGVPPGL LARYASADVS EPGWLRAAIG  660
KSASEASSGG AGRDESEAPL SEGLVAQGVA NTQFSPPLDG SFTALLKEVS DTIRRPPAGA  720
TRVQAHKPQA SGEGGELLRS FGSPPTSAGF GGTDSHLFGG DNSFFRWTVG SPLSEKQFLR  780
SASENESRGE PSAFVLQSSP PDETPLDPEQ TPHPCEELLP ARQSLESGSA GRGPGGLYLG  840
HEPPPQEPRA SWGAGAESGQ HSPPRKASVA NPALTKLVTE HLCSLLDQQA KQFNAVDPAN  900
PTRLDPDQVV KLREQHVQMR AAIAFLSTLT RSGTPVLPYE EGDNREGFGA SVADGSVSLV  960
SPSTPDSASS PIRTPYTEGG GKRPRRGGLL GGAMGGHSGK PVDVGPMQGL RLEEPGVGGG  1020
GEQATEGGGW NELPDDMGDS GDRLEETNAS GAGLKQGDRM PGWVGLEDPK APERIEPVGN  1080
GAEWHQWLAQ QVPPGQVPLP GDSAGGPDAT TAGADVAVRE AKEQSSHSAG HRSPSGASSD  1140
VEQRFAQCFL TWPDENQT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C2e-1389158777C-Myb DNA-Binding Domain
1mse_C2e-1389158777C-Myb DNA-Binding Domain
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.11e-13myb domain protein 98